|
Tocris
peptide ac2 26 Peptide Ac2 26, supplied by Tocris, used in various techniques. Bioz Stars score: 94/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/peptide ac2 26/product/Tocris Average 94 stars, based on 1 article reviews
peptide ac2 26 - by Bioz Stars,
2026-05
94/100 stars
|
Buy from Supplier |
|
Tocris
sag ![]() Sag, supplied by Tocris, used in various techniques. Bioz Stars score: 93/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/sag/product/Tocris Average 93 stars, based on 1 article reviews
sag - by Bioz Stars,
2026-05
93/100 stars
|
Buy from Supplier |
|
BioMimetic Therapeutics
pro-resolving annexin a1 biomimetic ac2-26 peptide ![]() Pro Resolving Annexin A1 Biomimetic Ac2 26 Peptide, supplied by BioMimetic Therapeutics, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/pro-resolving annexin a1 biomimetic ac2-26 peptide/product/BioMimetic Therapeutics Average 90 stars, based on 1 article reviews
pro-resolving annexin a1 biomimetic ac2-26 peptide - by Bioz Stars,
2026-05
90/100 stars
|
Buy from Supplier |
|
ChinaPeptides
ac2-26 (ac-amvseflkqawfieneeqeyvqtvk) ![]() Ac2 26 (Ac Amvseflkqawfieneeqeyvqtvk), supplied by ChinaPeptides, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/ac2-26 (ac-amvseflkqawfieneeqeyvqtvk)/product/ChinaPeptides Average 90 stars, based on 1 article reviews
ac2-26 (ac-amvseflkqawfieneeqeyvqtvk) - by Bioz Stars,
2026-05
90/100 stars
|
Buy from Supplier |
|
Bankpeptide biological technology co LTD
ac2-26 (ac-amvseflkqawfieneeqeyvqtvk ![]() Ac2 26 (Ac Amvseflkqawfieneeqeyvqtvk, supplied by Bankpeptide biological technology co LTD, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/ac2-26 (ac-amvseflkqawfieneeqeyvqtvk/product/Bankpeptide biological technology co LTD Average 90 stars, based on 1 article reviews
ac2-26 (ac-amvseflkqawfieneeqeyvqtvk - by Bioz Stars,
2026-05
90/100 stars
|
Buy from Supplier |
|
Biopeptide
peptides and antibodies murine ac2-26 (acetyl-amvseflkqarflenqeqeyvqavk) ![]() Peptides And Antibodies Murine Ac2 26 (Acetyl Amvseflkqarflenqeqeyvqavk), supplied by Biopeptide, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/peptides and antibodies murine ac2-26 (acetyl-amvseflkqarflenqeqeyvqavk)/product/Biopeptide Average 90 stars, based on 1 article reviews
peptides and antibodies murine ac2-26 (acetyl-amvseflkqarflenqeqeyvqavk) - by Bioz Stars,
2026-05
90/100 stars
|
Buy from Supplier |
|
GenScript corporation
ac2 26 ![]() Ac2 26, supplied by GenScript corporation, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/ac2 26/product/GenScript corporation Average 90 stars, based on 1 article reviews
ac2 26 - by Bioz Stars,
2026-05
90/100 stars
|
Buy from Supplier |
|
Topscience Co Ltd
ac2-26 ![]() Ac2 26, supplied by Topscience Co Ltd, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/ac2-26/product/Topscience Co Ltd Average 90 stars, based on 1 article reviews
ac2-26 - by Bioz Stars,
2026-05
90/100 stars
|
Buy from Supplier |
|
ChinaPeptides
cy5-labeled ac2-26 ![]() Cy5 Labeled Ac2 26, supplied by ChinaPeptides, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/cy5-labeled ac2-26/product/ChinaPeptides Average 90 stars, based on 1 article reviews
cy5-labeled ac2-26 - by Bioz Stars,
2026-05
90/100 stars
|
Buy from Supplier |
|
GenicBio BioTech Co Ltd
ac2-26 ![]() Ac2 26, supplied by GenicBio BioTech Co Ltd, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/ac2-26/product/GenicBio BioTech Co Ltd Average 90 stars, based on 1 article reviews
ac2-26 - by Bioz Stars,
2026-05
90/100 stars
|
Buy from Supplier |
|
GL Biochem
anxa1 n-terminal-derived mimetic peptide (ac2-26 ![]() Anxa1 N Terminal Derived Mimetic Peptide (Ac2 26, supplied by GL Biochem, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/anxa1 n-terminal-derived mimetic peptide (ac2-26/product/GL Biochem Average 90 stars, based on 1 article reviews
anxa1 n-terminal-derived mimetic peptide (ac2-26 - by Bioz Stars,
2026-05
90/100 stars
|
Buy from Supplier |
|
GL Biochem
1μm annexin a1 n-terminal derived peptide ac2-26 (ac-amvseflkqawfieneeqeyvqtvk) ![]() 1μm Annexin A1 N Terminal Derived Peptide Ac2 26 (Ac Amvseflkqawfieneeqeyvqtvk), supplied by GL Biochem, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/1μm annexin a1 n-terminal derived peptide ac2-26 (ac-amvseflkqawfieneeqeyvqtvk)/product/GL Biochem Average 90 stars, based on 1 article reviews
1μm annexin a1 n-terminal derived peptide ac2-26 (ac-amvseflkqawfieneeqeyvqtvk) - by Bioz Stars,
2026-05
90/100 stars
|
Buy from Supplier |
Image Search Results
Journal: Molecular Cancer
Article Title: Hedgehog signaling drives glial cell plasticity and oncogenic reprogramming in gastroenteropancreatic neuroendocrine neoplasms
doi: 10.1186/s12943-026-02611-y
Figure Lengend Snippet: Patient-derived PanNET tumoroids express HH signaling proteins and respond to HH pathway activation and inhibition. A Combined fluorescence and phase-contrast images of 21-day-old human PanNET tumoroids (PanNET3) stained for chromogranin A (CHGA) and HH proteins (PTCH1, SHH). B Four patient-derived PanNET tumoroid lines (PanNET1–4) were exposed to recombinant human SHH N-terminal peptide (100 ng/mL) or the SMO inhibitor vismodegib (VISMO, 20 µM) for 72 h and changes in mRNA expression were analyzed by RT-qPCR. mRNA changes were normalized to HPRT1 expression and DMSO vehicle control. ( n = 4 unique patient lines). * = p < 0.05, ** = p < 0.01, **** = p < 0.0001 by Two-way ANOVA with Sidak post-test. C EdU labeling showing proliferation of dissociated PanNET3 cells following 5-day exposure to: the HH agonists SHH-N (100 ng/mL) and SAG (10 nM); inhibitors of the canonical HH signaling pathway vismodegib (20 µM) and sonidegib (10 nM); or inhibitors of the GLI1/2 effectors GANT61 (10 µM) and itraconazole (ITZ, 1 µM). D Quantitation of the percentage of EdU-positive PanNET tumor cells following 5-day treatment. ( n = 3 replicates from one patient tumoroid line). * = p < 0.05, by One-way ANOVA with Tukey post-test. E SHH or SAG were co-administered with the respective pharmacologic inhibitors and EdU uptake was evaluated after 7 days. F Immunofluorescent images of CHGA, SHH, and PTCH1 expression in a second PanNET tumoroid line (PanNET5). G , H EdU labeling was evaluated in PanNET5 tumoroids following 7-day treatment with SHH-N (200 ng/mL) and SAG (20 nM); inhibitors of the canonical HH signaling pathway vismodegib (20 µM) and sonidegib (10 nM); or inhibitors of the GLI1/2 effectors GANT61 (10 µM) and itraconazole (ITZ, 5 µM). I Crystal violet staining of human BON-1 PanNET cells after 48 h treatment. J BrdU incorporation in BON-1 cells after 48 h treatment with HH agonists SHH-N and SAG, ( K ) SMO inhibitors vismodegib and sonidegib, and ( L ) inhibitors of GLI1/2 signaling. M Immunofluorescent images of CHGA, SHH, and PTCH1 expression in tumoroids derived from a metastatic ileal NET (IL-NET-met1). N , O EdU labeling was assayed in the IL-NET-met1 tumoroid line following 7-day treatment with the same drug concentrations used for PanNET5. * = p < 0.05, ** = p < 0.01, *** = p < 0.001, **** = p < 0.0001 by One-way ANOVA with Dunnett post-test
Article Snippet: Drug compounds used in the studies include: human recombinant SHH N-terminal peptide (R&D Systems, Cat# 1845-GMP),
Techniques: Derivative Assay, Activation Assay, Inhibition, Fluorescence, Staining, Recombinant, Expressing, Quantitative RT-PCR, Control, Labeling, Quantitation Assay, BrdU Incorporation Assay
Journal: Molecular Cancer
Article Title: Hedgehog signaling drives glial cell plasticity and oncogenic reprogramming in gastroenteropancreatic neuroendocrine neoplasms
doi: 10.1186/s12943-026-02611-y
Figure Lengend Snippet: HH signaling regulates the growth of GFAP ΔMen1 and Sox10 ΔMen1 pancreatic NET tumoroids. A Phase contrast and ( B ) fluorescence images of PanNET tumoroids from Sox10-Cre; Men1 FL/FL ; LSL-tdTomato mice. Tumoroids were imaged after 72 h exposure to: the HH agonists SHH-N (100 ng/mL) and SAG (10 nM); inhibitors of the canonical HH signaling pathway vismodegib (20 µM) and sonidegib (10 nM); or inhibitors of the GLI1/2 effectors GANT61 (10 µM) and itraconazole (ITZ, 1 µM). C TdTomato fluorescence intensity was used to measure PanNET tumoroid growth in the presence of HH pathway agonists or ( D ) inhibitors of the canonical and ( E ) non-canonical HH signaling pathways. Fluorescence signal is compared to DMSO vehicle control. ( n = 3 replicates in two unique mouse PanNET tumoroid lines). ** = p < 0.01, *** = p < 0.001, **** = p < 0.0001 by One-way ANOVA with Dunnett post-test. F BrdU incorporation was used to measure tumoroid proliferation in GFAP ΔMen1 and Sox10 ΔMen1 PanNET tumoroids after 72 h treatment. ( n = 4). ** = p < 0.01, **** = p < 0.0001 by One-way ANOVA with Dunnett post-test. G Relative fold-change in Chga mRNA levels in PanNET tumoroids following 72 h treatment. ( n = 5). H Western blot analysis of HH pathway proteins in PanNET tumoroids after 72 h treatment. I Quantitation of SHH protein expression normalized to beta-actin and DMSO vehicle control from the western blot analysis in panel ( H ). ( n = 3). J Western blot analysis and ( K ) associated quantitation of phosphorylated and total ERK and AKT growth pathways in PanNET tumoroids after 72 h treatment. ( n = 3). * = p < 0.05, ** = p < 0.01, *** = p < 0.001 by Kruskal-Wallis test
Article Snippet: Drug compounds used in the studies include: human recombinant SHH N-terminal peptide (R&D Systems, Cat# 1845-GMP),
Techniques: Fluorescence, Protein-Protein interactions, Control, BrdU Incorporation Assay, Western Blot, Quantitation Assay, Expressing
Journal: Molecular Cancer
Article Title: Hedgehog signaling drives glial cell plasticity and oncogenic reprogramming in gastroenteropancreatic neuroendocrine neoplasms
doi: 10.1186/s12943-026-02611-y
Figure Lengend Snippet: GFAP ΔMen1 DNETs and jejunal NETs are sensitive to HH pathway activation and inhibition. A Phase contrast and ( B ) fluorescence images of DNET tumoroids from a GFAP-Cre; Men1 FL/FL ; LSL-tdTomato mouse. Tumoroids were imaged after 72 h exposure to: the HH agonists SHH-N (100 ng/mL) and SAG (10 nM); inhibitors of the canonical HH signaling pathway vismodegib (20 µM) and sonidegib (10 nM); or inhibitors of the GLI1/2 effectors GANT61 (10 µM) and itraconazole (ITZ, 1 µM). C TdTomato fluorescence intensity was used to measure DNET tumoroid growth in the presence of HH pathway inhibitors. Fluorescence signal is compared to DMSO vehicle control. ( n = 3 replicates using one mouse DNET tumoroid line). ** = p < 0.01, *** = p < 0.001, **** = p < 0.0001 by One-way ANOVA with Dunnett post-test. D Relative BrdU incorporation in a second GFAP ΔMen1 DNET tumoroid line and ( E ) a jejunal tumoroid line (J-NET) after 72 h treatment. ( n = 4). ** = p < 0.01, *** = p < 0.001, **** = p < 0.0001 by One-way ANOVA with Dunnett post-test. F Western blot analysis of SHH, ERK, and AKT growth pathways in J-NET tumoroids after 72 h treatment. G Western blot quantitation of SHH and ( H ) phosphorylated and total ERK and AKT proteins normalized to GAPDH and DMSO vehicle control. ( n = 3). * = p < 0.05 by Kruskal-Wallis test. I Crystal violet staining of mouse STC-1 SI-NET cells after 48 h treatment with agonists and inhibitors of the HH signaling pathway. J BrdU incorporation in STC-1 cells after 48 h treatment with HH agonists SHH-N and SAG, ( K ) SMO inhibitors vismodegib and sonidegib, and ( L ) inhibitors of GLI1/2 signaling. * = p < 0.05, ** = p < 0.01, *** = p < 0.001, **** = p < 0.0001 by One-way ANOVA with Dunnett post-test
Article Snippet: Drug compounds used in the studies include: human recombinant SHH N-terminal peptide (R&D Systems, Cat# 1845-GMP),
Techniques: Activation Assay, Inhibition, Fluorescence, Control, BrdU Incorporation Assay, Western Blot, Quantitation Assay, Staining
Journal: Cardiovascular Diabetology
Article Title: ANXA1-FPR2 axis mitigates the susceptibility to atrial fibrillation in obesity via rescuing AMPK activity in response to lipid overload
doi: 10.1186/s12933-024-02545-z
Figure Lengend Snippet: Physical characteristics, echocardiographic, electrophysiological parameters, and metabolism-related indicators in mice from STD, STD + Ac2-26, HFD, and HFD + Ac2-26 groups
Article Snippet: The mice were intraperitoneally injected with
Techniques: